PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00132564001
Common NameGSBRNA2T00132564001, LOC106427741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 294aa    MW: 31399.3 Da    PI: 8.8832
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00132564001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-3871130362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg r+n++++
  GSBRNA2T00132564001  71 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKSCRRYWTRGGSLRNVPVGGGYRRNRHTK 130
                          7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3458128IPR003851Zinc finger, Dof-type
PfamPF027013.6E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.96674128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGFFSIQAYP DSSNWQQAPP NNHNQGGAGA SDTGGHGICP QPQSNGSGGS GSIRPGSMVD  60
RARQANVAMP EAALKCPRCE STNTKFCYFN NYSLTQPRHF CKSCRRYWTR GGSLRNVPVG  120
GGYRRNRHTK SSSNNNNSTA TSNNTSFSSA ASGNASTINA ILSPNYGGNH ESILSQILYP  180
GRVMNPNYNH HLGDLLDNTK TDNNMSLLNY GGLSQDLRSV HMGTSGGSLM SCVDPSSNGF  240
YPFESPRTTS TSISSALASQ FSSVKVEDNP YKWVNVNGNC SSWIDLSTFG SSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00132564001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723912.10.0PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-138DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078CX780.0A0A078CX78_BRANA; BnaC03g20790D protein
STRINGBra000008.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-117DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]